PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100231630071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family MYB
Protein Properties Length: 292aa    MW: 33727.6 Da    PI: 10.06
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100231630071genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171863147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  rg W + Ede+l + v+++G+ +W++Ia++++ gR++k+c++rw++ 
  Ote100231630071|100231630071 18 RGHWRPAEDEKLRQIVEKYGPQNWNSIAERLQ-GRSGKSCRLRWFNQ 63
                                  899*****************************.***********996 PP

2Myb_DNA-binding57.82.4e-1870113146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   r ++++eE+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ 
  Ote100231630071|100231630071  70 RRPFSEEEEERLLAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHV 113
                                   679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3761364IPR017930Myb domain
SuperFamilySSF466891.8E-2917111IPR009057Homeodomain-like
SMARTSM007171.7E-141766IPR001005SANT/Myb domain
PfamPF002491.6E-171863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-261971IPR009057Homeodomain-like
CDDcd001672.61E-132162No hitNo description
PROSITE profilePS5129427.38865119IPR017930Myb domain
SMARTSM007171.2E-1569117IPR001005SANT/Myb domain
PfamPF002493.0E-1570112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-2172118IPR009057Homeodomain-like
CDDcd001675.32E-781112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDETTCRGSG DDLRTCPRGH WRPAEDEKLR QIVEKYGPQN WNSIAERLQG RSGKSCRLRW  60
FNQLDPRINR RPFSEEEEER LLAAHRIHGN KWALISRLFP GRTDNAVKNH WHVIMARKQR  120
EKSKISGKIR ANQDHNADSK SPTNYVFRPK TNSRLQEEYG SKISFENGGI FDSQTQQHKD  180
KIFPLSSFSG WPNNLSSYSP KLYGRRNYKL PHLQTNFSIF SPYDDSFESR VSKTAIPNLF  240
SYSTCGALDR EWTSSGEGSF HFGKTRTNAE QDKSMEKKDV PFIDFLGVGI SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31181187107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101908.11e-134PREDICTED: transcription factor MYB113
TrEMBLA0A059PRX51e-146A0A059PRX5_SALMI; MYB-related transcription factor
STRINGSolyc04g064540.2.13e-88(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466